Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant UPF0442 protein YPTB0627 (YPTB0627)

This Recombinant UPF0442 protein YPTB0627 (YPTB0627) spans the amino acid sequence from region 1-156.

Product Specifications

Product Name Alternative

UPF0442 protein YPTB0627

UniProt

Q66ER4

Expression Region

1-156

Origin

Yersinia pseudotuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGVSLLWALLQDMVLAAIPALGFAMVFNVPVRALRYCALLGAIGHGSRMLMIHFGMNIEL ASLVASIMIGVIGINWSRWLLAHPKVFTVAAVIPMFPGISAYTAMISVVEISHLGYSEAL MSTMVTNFLKASFIVGALSIGLSLPGLWLYRKRPGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL
BNC400031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL
BNC940745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF405S conjugate, 0.1mg/mL
BNC041052-100 1x 100 µL

CD3e (B-B12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL
BNC881231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF640R conjugate, 0.1mg/mL
BNC400225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7/903), CF405S conjugate, 0.1mg/mL
BNC040903-500 1x 500 µL

Cytokeratin 7 (KRT7/903), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details