Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein SYS1 homolog (Sys1)

This Recombinant Mouse Protein SYS1 homolog (Sys1) spans the amino acid sequence from region 1-156.

Product Specifications

Product Name Alternative

Protein SYS1 homolog

UniProt

Q78S06

Expression Region

1-156

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGQFRSYVWDPLLILSQIVLMQTVYYGSLGLWLALVDALVRSSPSLDQMFDAEILGFST PPGRLSMMSFVLNALTCALGLLYFIRRGKQCLDFTVTVHFFHLLGCWLYSSRFPSALTWW LVQAVCIALMAVIGEYLCMRTELKEIPLSSAPKSNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho C-Jun (Thr91, Thr93) (C-J 4C4/1), 0.2mg/mL
BNUB2282-500 1x 500 µL

Phospho C-Jun (Thr91, Thr93) (C-J 4C4/1), 0.2mg/mL

Sign In for Pricing
View Details
1-(6-Amino-9-Beta-D-ribofuranosyl-9H-purin-2-yl)-1H-pyrazole-4-carboxylic AcidEthyl Ester
TRC-A629210-5MG 5 mg

1-(6-Amino-9-Beta-D-ribofuranosyl-9H-purin-2-yl)-1H-pyrazole-4-carboxylic AcidEthyl Ester

Sign In for Pricing
View Details
CYP20A1 Rabbit Polyclonal Antibody
TA362310 100 µL

CYP20A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(S)-5-Fluoro ADB
TRC-F587245-1MG 1 mg

(S)-5-Fluoro ADB

Sign In for Pricing
View Details
Phospho-Axl (Y702) Recombinant Rabbit monoclonal Antibody
HA723963 100 µL

Phospho-Axl (Y702) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
TrkA (NTRK1) Rabbit Polyclonal Antibody
AP09509PU-S 50 µL

TrkA (NTRK1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details