Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein SYS1 homolog (Sys1)

This Recombinant Mouse Protein SYS1 homolog (Sys1) spans the amino acid sequence from region 1-156.

Product Specifications

Product Name Alternative

Protein SYS1 homolog

UniProt

Q78S06

Expression Region

1-156

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGQFRSYVWDPLLILSQIVLMQTVYYGSLGLWLALVDALVRSSPSLDQMFDAEILGFST PPGRLSMMSFVLNALTCALGLLYFIRRGKQCLDFTVTVHFFHLLGCWLYSSRFPSALTWW LVQAVCIALMAVIGEYLCMRTELKEIPLSSAPKSNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XPNPEP3 Rabbit Polyclonal Antibody
TA365885 100 µL

XPNPEP3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant COX6B1 Antibody
RC-16505-01 50 μL

Recombinant COX6B1 Antibody

Sign In for Pricing
View Details
Recombinant COX6B1 Antibody
RC-16505-02 100 µL

Recombinant COX6B1 Antibody

Sign In for Pricing
View Details
Recombinant COX6B1 Antibody
RC-16505-03 1 mL

Recombinant COX6B1 Antibody

Sign In for Pricing
View Details
9-Aminoacridine
TRC-A190880-1G 1 g

9-Aminoacridine

Sign In for Pricing
View Details
TentaGel® S NH₂
S30902.100G 100 g

TentaGel® S NH₂

Sign In for Pricing
View Details