Recombinant Manduca sexta V-type proton ATPase 16 kDa proteolipid subunit (VHA16)
This Recombinant Manduca sexta V-type proton ATPase 16 kDa proteolipid subunit (VHA16) spans the amino acid sequence from region 1-156.
Product Specifications
Product Name Alternative
V-type proton ATPase 16 kDa proteolipid subunit, V-ATPase 16 kDa proteolipid subunit, Vacuolar proton pump 16 kDa proteolipid subunit
UniProt
P31403
Expression Region
1-156
Origin
Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAENPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAG IIAIYGLVVAVLIAGSLDSPSNNYTLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRG TAQQPRLFVGMILILIFAEVLGLYGLIVAIYLYTKQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC471820-100 1x 100 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470669-100 1x 100 µL
P27 / KIP1 (SX53G8), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041003-100 1x 100 µL
Mucin 5AC (MUC5AC) (58M1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682853-100 1x 100 µL
CD54 / ICAM-1 (15.2), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 