Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yxjN (yxjN)

This Recombinant Bacillus subtilis Uncharacterized protein yxjN (yxjN) spans the amino acid sequence from region 1-157.

Product Specifications

Product Name Alternative

Uncharacterized protein yxjN

UniProt

P55182

Expression Region

1-157

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAMSPYIFIVLILIILSMYRERTVKPGKLLIIPLLLLWGVSASFQPAYFHSVLHVAISGI LLLIGLACGFGIGKMVNVRIHPETGKVTSRGSLGSVILILVILSLRMAARTWLPESNEMF IAIIHSMFFVPLGTITARNIMLYKAYRRLTAGKVSIQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn1r202 Mouse Gene Knockout Kit (CRISPR)
KN518995 1 Kit

Vmn1r202 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Girard's Reagent T
TRC-G388505-100G 100 g

Girard's Reagent T

Sign In for Pricing
View Details
BMPR1A Human, IgG-His
OM296884-01 10 µg

BMPR1A Human, IgG-His

Sign In for Pricing
View Details
BMPR1A Human, IgG-His
OM296884-02 2 µg

BMPR1A Human, IgG-His

Sign In for Pricing
View Details
BMPR1A Human, IgG-His
OM296884-03 1 mg

BMPR1A Human, IgG-His

Sign In for Pricing
View Details
4-(1-Piperazinyl)-1H-indole Dihydrochloride
TRC-P481250-25MG 25 mg

4-(1-Piperazinyl)-1H-indole Dihydrochloride

Sign In for Pricing
View Details