What is the catalog number for Recombinant Inner membrane protein CbrB (cbrB)?

The catalog number for Recombinant Inner membrane protein CbrB (cbrB) is orb2920688.

What sizes are available for Recombinant Inner membrane protein CbrB (cbrB)?

Recombinant Inner membrane protein CbrB (cbrB) is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant Inner membrane protein CbrB (cbrB) come in?

Recombinant Inner membrane protein CbrB (cbrB) is available in 2 different pack sizes.

Is Recombinant Inner membrane protein CbrB (cbrB) in stock?

Recombinant Inner membrane protein CbrB (cbrB) is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Inner membrane protein CbrB (cbrB)

This Recombinant Inner membrane protein CbrB (cbrB) spans the amino acid sequence from region 1-157.

Product Specifications

Product Name Alternative

Inner membrane protein CbrB

UniProt

A1AHP9

Expression Region

1-157

Origin

Escherichia coli O1:K1 / APEC

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVSRRVIHHGLYFAVLGPLIGVLFLVLYIFFAKEPLILLVIIQVLPLFLLMSITTGAIP AMLTGVMVACLPEKIGSQKRYRCLVGGIGGVVITEIYCAVIVHIKDMASSALFENILSGE NLVVRIIPALLAGVVMSRIITHLPGLDISCPETDSLS