Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacter sp. UPF0442 protein Ent638_0521 (Ent638_0521)

This Recombinant Enterobacter sp. UPF0442 protein Ent638_0521 (Ent638_0521) spans the amino acid sequence from region 1-157.

Product Specifications

Product Name Alternative

UPF0442 protein Ent638_0521

UniProt

A4W678

Expression Region

1-157

Origin

Enterobacter sp. (strain 638)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGIIEFLLALAQDMALSAIPAVGFAMVFNVPHRALRWCALLGAIGHGSRMVMMTAGFNIE WSTFMASMLVGCIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISHFGYSEP QMILLLSNFLKASSIVGALSIGLSIPGLWLYRKRPRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (CB-CALLA), CF647 conjugate, 0.1mg/mL
BNC470146-500 1x 500 µL

CD10 (CB-CALLA), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF488A conjugate, 0.1mg/mL
BNC880437-500 1x 500 µL

CD47 (B6H12.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF647 conjugate, 0.1mg/mL
BNC470338-500 1x 500 µL

P53 (PAb122), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (L1C1), CF568 conjugate, 0.1mg/mL
BNC680018-500 1x 500 µL

Human Kappa Light Chain (L1C1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD6 (Negative Marker of T-regulatory Cells) (C6/2884R), CF594 conjugate, 0.1mg/mL
BNC942884-100 1x 100 µL

CD6 (Negative Marker of T-regulatory Cells) (C6/2884R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF594 conjugate, 0.1mg/mL
BNC940345-500 1x 500 µL

CD4 (EDU-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details