Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Citrobacter koseri UPF0442 protein CKO_03436 (CKO_03436)

This Recombinant Citrobacter koseri UPF0442 protein CKO_03436 (CKO_03436) spans the amino acid sequence from region 1-157.

Product Specifications

Product Name Alternative

UPF0442 protein CKO_03436

UniProt

A8AM03

Expression Region

1-157

Origin

Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGVIDFLLALMQDMILSAIPAVGFAMVFNVPHRALPWCALLGALGHGSRMVMMTAGFNIE WSTFMASLLVGSIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISHFGYSEP LMITLLTNFLKASSIVGALSIGLSVPGLWLYRKRPRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ankrd61 Mouse Gene Knockout Kit (CRISPR)
KN501302 1 Kit

Ankrd61 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RFPL4A Human Gene Knockout Kit (CRISPR)
KN427429 1 Kit

RFPL4A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometriotic tissue
CS510081 5x 5 µm

Frozen Tissue Sections, Endometriotic tissue

Sign In for Pricing
View Details
Frozen Tissue Sections, Artery: peripheral
CS626742 5x 5 µm

Frozen Tissue Sections, Artery: peripheral

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS803792 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Human MRPS7 activation kit by CRISPRa
GA109546 1 Kit

Human MRPS7 activation kit by CRISPRa

Sign In for Pricing
View Details