Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella flexneri serotype 5b Inner membrane protein CbrB (cbrB)

This Recombinant Shigella flexneri serotype 5b Inner membrane protein CbrB (cbrB) spans the amino acid sequence from region 1-157.

Product Specifications

Product Name Alternative

Inner membrane protein CbrB

UniProt

Q0SYQ7

Expression Region

1-157

Origin

Shigella flexneri serotype 5b (strain 8401)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVSRRVIHHGLYFAVLGPLIGVLFLVLYIFFAKEPLVLLVIIQVLPLFLLLSITTGAIP ALLTGVMVACLPEKIGSQKNYRCLAGGIGGVVITEIYCAVIVHIKGMASSELFENILSGD SLVVRIIPALLAGVVMSRIITRLPGLDISCPETDSLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Invadolysin (LmLN) (NM_001136049) Human Over-expression Lysate
LY427793 100 µg

Invadolysin (LmLN) (NM_001136049) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS640994 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
XCC
TRC-X745160-250MG 250 mg

XCC

Sign In for Pricing
View Details
Ube2r2 Mouse Gene Knockout Kit (CRISPR)
KN518589 1 Kit

Ube2r2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MEK4 (MAP2K4) pThr261 Rabbit Polyclonal Antibody
AP01679PU-N 100 µg

MEK4 (MAP2K4) pThr261 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IKK-α (Ab-23) Antibody
8B7117-AAT 50 µg

IKK-α (Ab-23) Antibody

Sign In for Pricing
View Details