Recombinant Staphylococcus aureus Multidrug resistance efflux pump sepA (sepA)
This Recombinant Staphylococcus aureus Multidrug resistance efflux pump sepA (sepA) spans the amino acid sequence from region 1-157.
Product Specifications
Product Name Alternative
Multidrug resistance efflux pump sepA, Antiseptic resistance protein sepA, Staphylococcal efflux pump A
UniProt
Q2YYH7
Expression Region
1-157
Origin
Staphylococcus aureus (strain bovine RF122 / ET3-1)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MIVNYLKNKFYNLLTTMIVLFIFVLSGAIFLTFLGFGLYGLSRILIYFRLGDFTYNRSMY DNLLYYGSYIIFGYFIIFAVEHLMDYFRKMLPENAYFRGATFHLISYTVATTLFYFIIHL NYVYINIDFWVIMVIIGFLYVCKLQFYPESKNLNNRK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC401429-100 1x 100 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400270-100 1x 100 µL
Fibronectin (HFN7.1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC742829-100 1x 100 µL
Golgi Complex (Marker for Human Cells) (GLG1/2829R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details