Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant UPF0442 protein yjjB (yjjB)

This Recombinant UPF0442 protein yjjB (yjjB) spans the amino acid sequence from region 1-157.

Product Specifications

Product Name Alternative

UPF0442 protein yjjB

UniProt

Q8Z0W0

Expression Region

1-157

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGIIDFLLALMQDMILSAIPAVGFAMVFNVPHRALPWCALLGALGHGLRMLMMSAGFNIE WSTFMASLLVGSIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISHLGYSEP MMITLLTNFLKASSIVGALSIGLSVPGLWLYRKRPRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (CB-CALLA), CF680 conjugate, 0.1mg/mL
BNC800146-500 1x 500 µL

CD10 (CB-CALLA), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF555 conjugate, 0.1mg/mL
BNC551037-500 1x 500 µL

CD44 Standard (DF1485), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF488A conjugate, 0.1mg/mL
BNC880449-500 1x 500 µL

CD104 (UM-A9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD117 (KIT/983), CF405S conjugate, 0.1mg/mL
BNC040983-500 1x 500 µL

CD117 (KIT/983), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC16 / CA125 (Ovarian Carcinoma Marker) (OCA125/2349R), CF647 conjugate, 0.1mg/mL
BNC472349-100 1x 100 µL

MUC16 / CA125 (Ovarian Carcinoma Marker) (OCA125/2349R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD29 (Stem Cell Marker) (12G10), CF405S conjugate, 0.1mg/mL
BNC042905-100 1x 100 µL

CD29 (Stem Cell Marker) (12G10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details