Recombinant Staphylococcus aureus Multidrug resistance efflux pump sepA (sepA)
This Recombinant Staphylococcus aureus Multidrug resistance efflux pump sepA (sepA) spans the amino acid sequence from region 1-157.
Product Specifications
Product Name Alternative
Multidrug resistance efflux pump sepA, Antiseptic resistance protein sepA, Staphylococcal efflux pump A
UniProt
Q8NVE1
Expression Region
1-157
Origin
Staphylococcus aureus (strain MW2)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MIVNYLKHKFYNLLTTMVVLFIFVLSGAIFLTFLGFGLYGLSRILIYFRLGDFTYNRSMY DNLLYYGSYIIFGYFIIFAVEHLMDYFRKMLPENAYFRGATFHLISYTVATTLFYFIIHL NYVYINIDFWVIMVIIGFLYVCKLQFYPESKNLNNRK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040460-100 1x 100 µL
CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401060-100 1x 100 µL
Chromogranin A (CGA414 + CGA/777 + CGA/798), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC550809-500 1x 500 µL
Cyclin D1 (CCND1/809), CF555 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470354-500 1x 500 µL
AFP (Alpha Fetoprotein) (C3), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040715-500 1x 500 µL
Thymidylate Synthase (TMS715), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details