Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Multidrug resistance efflux pump sepA (sepA)

This Recombinant Multidrug resistance efflux pump sepA (sepA) spans the amino acid sequence from region 1-157.

Product Specifications

Product Name Alternative

Multidrug resistance efflux pump sepA, Antiseptic resistance protein sepA, Staphylococcal efflux pump A

UniProt

Q99S98

Expression Region

1-157

Origin

Staphylococcus aureus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIVNYLKHKFYNLLTTMIVLFIFVLSGAIFLTFLGFGLYGLSRILIYFRLGDFTYNRSMY DNLLYYGSYIIFGYFIIFAVEHLMDYFRKMLPENAYFRGATFHLISYTVATTLFYFIIHL NYVYINIDFWVIMVIIGFLYVCKLQFYPESKNLNNRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (HFN7.1), CF640R conjugate, 0.1mg/mL
BNC400270-100 1x 100 µL

Fibronectin (HFN7.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL
BNC050017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL
BNC942216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF647 conjugate, 0.1mg/mL
BNC470189-100 1x 100 µL

CD74 (BU45), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1409R), CF568 conjugate, 0.1mg/mL
BNC681409-500 1x 500 µL

MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1409R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), 0.2mg/mL
BNUB0160-500 1x 500 µL

CD20 (B9E9), 0.2mg/mL

Sign In for Pricing
View Details