Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Epithelial membrane protein 1 (EMP1)

This Recombinant Human Epithelial membrane protein 1 (EMP1) spans the amino acid sequence from region 1-157.

Product Specifications

Product Name Alternative

Epithelial membrane protein 1, EMP-1, CL-20, Protein B4B, Tumor-associated membrane protein

UniProt

P54849

Expression Region

1-157

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLVLLAGIFVVHIATVIMLFVSTIANVWLVSNTVDASVGLWKNCTNISCSDSLSYASEDA LKTVQAFMILSIIFCVIALLVFVFQLFTMEKGNRFFLSGATTLVCWLCILVGVSIYTSHY ANRDGTQYHHGYSYILGWICFCFSFIIGVLYLVLRKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MHC II (HLA-DP) (beta chain) (Bra-14), Biotin conjugate, 0.1mg/mL
BNCB1129-500 1x 500 µL

MHC II (HLA-DP) (beta chain) (Bra-14), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GNPTG (NM_032520) Human Over-expression Lysate
LY403165 100 µg

GNPTG (NM_032520) Human Over-expression Lysate

Sign In for Pricing
View Details
ROR1 (NM_005012) Human Recombinant Protein
TP314967 20 µg

ROR1 (NM_005012) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Rat EGFR/ErbB1 Protein (His Tag)
PKSR030363 100 µg

Recombinant Rat EGFR/ErbB1 Protein (His Tag)

Sign In for Pricing
View Details
Mouse Wif1 activation kit by CRISPRa
GA204908 1 Kit

Mouse Wif1 activation kit by CRISPRa

Sign In for Pricing
View Details
2-Amino-2-phenylbutyric Acid
TRC-A634925-500MG 500 mg

2-Amino-2-phenylbutyric Acid

Sign In for Pricing
View Details