Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Epithelial membrane protein 1 (EMP1)

This Recombinant Human Epithelial membrane protein 1 (EMP1) spans the amino acid sequence from region 1-157.

Product Specifications

Product Name Alternative

Epithelial membrane protein 1, EMP-1, CL-20, Protein B4B, Tumor-associated membrane protein

UniProt

P54849

Expression Region

1-157

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLVLLAGIFVVHIATVIMLFVSTIANVWLVSNTVDASVGLWKNCTNISCSDSLSYASEDA LKTVQAFMILSIIFCVIALLVFVFQLFTMEKGNRFFLSGATTLVCWLCILVGVSIYTSHY ANRDGTQYHHGYSYILGWICFCFSFIIGVLYLVLRKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIM domain only 3 (LMO3) (NM_018640) Human Recombinant Protein
TP305190M 100 µg

LIM domain only 3 (LMO3) (NM_018640) Human Recombinant Protein

Sign In for Pricing
View Details
Angiopoietin like 4 (ANGPTL4) (NM_001039667) Human Over-expression Lysate
LY422106 100 µg

Angiopoietin like 4 (ANGPTL4) (NM_001039667) Human Over-expression Lysate

Sign In for Pricing
View Details
Xanthoplanine Iodide
TRC-X100100-25MG 25 mg

Xanthoplanine Iodide

Sign In for Pricing
View Details
rac-4-Hydroxy Mavacamten
TRC-H299815-50MG 50 mg

rac-4-Hydroxy Mavacamten

Sign In for Pricing
View Details
Tissue Total RNA, Metastasis, unknown source
CR559800 5 µg

Tissue Total RNA, Metastasis, unknown source

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometrium
CS508836 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details