Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Epithelial membrane protein 1 (EMP1)

This Recombinant Human Epithelial membrane protein 1 (EMP1) spans the amino acid sequence from region 1-157.

Product Specifications

Product Name Alternative

Epithelial membrane protein 1, EMP-1, CL-20, Protein B4B, Tumor-associated membrane protein

UniProt

P54849

Expression Region

1-157

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLVLLAGIFVVHIATVIMLFVSTIANVWLVSNTVDASVGLWKNCTNISCSDSLSYASEDA LKTVQAFMILSIIFCVIALLVFVFQLFTMEKGNRFFLSGATTLVCWLCILVGVSIYTSHY ANRDGTQYHHGYSYILGWICFCFSFIIGVLYLVLRKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCT6B Rabbit Polyclonal Antibody
TA374408 100 µL

CCT6B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IKK-α/β (Ab-176/177) Antibody
8B0441-AAT 50 µg

IKK-α/β (Ab-176/177) Antibody

Sign In for Pricing
View Details
NCoR1 Antibody
8C0358-AAT 50 µg

NCoR1 Antibody

Sign In for Pricing
View Details
Smim7 Mouse Gene Knockout Kit (CRISPR)
KN516330 1 Kit

Smim7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
tert-Butyl-d9-amine
TRC-B690777-500MG 500 mg

tert-Butyl-d9-amine

Sign In for Pricing
View Details
IL36A Human
OM296396-01 10 µg

IL36A Human

Sign In for Pricing
View Details