Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 50B (Tmem50b)

This Recombinant Mouse Transmembrane protein 50B (Tmem50b) spans the amino acid sequence from region 1-158.

Product Specifications

Product Name Alternative

Transmembrane protein 50B

UniProt

Q9D1X9

Expression Region

1-158

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGFLDNFRWPECECIDWSERRNTVASVVAGILFFTGWWIMIDAAVVYPKPEQLNHAFHT CGVFSTLAFFMINAVSNAQVRGDSYESGCLGRTGARVWLFIGFMLMFGSLIASMWILFGA YVTQNIDVYPGLAVFFQNALIFFSTLIYKFGRTEELWA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

rac-Nicotine-d3
TRC-N412425-50MG 50 mg

rac-Nicotine-d3

Sign In for Pricing
View Details
CD74 (LN-2), 1mg/mL
BNUM0056-50 1x 50 µL

CD74 (LN-2), 1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS509924 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
RASSF9 Polyclonal Antibody
E-AB-11523-01 20 µL

RASSF9 Polyclonal Antibody

Sign In for Pricing
View Details
RASSF9 Polyclonal Antibody
E-AB-11523-02 60 µL

RASSF9 Polyclonal Antibody

Sign In for Pricing
View Details
RASSF9 Polyclonal Antibody
E-AB-11523-03 120 µL

RASSF9 Polyclonal Antibody

Sign In for Pricing
View Details