Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit E1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit E1 spans the amino acid sequence from region 1-159.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit E1, Mnh complex subunit E1

UniProt

P60689

Expression Region

1-159

Origin

Staphylococcus aureus (strain N315)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVQLVLNFIIAVFWLFVTNSYTTNNFVLGFIFGLVLVYLLHRVLPGRFYVITLYRIIKL VIIFLIELIKANFDVLKIIIKPSIKNEPGFFVYHTDLKKDWQIVLLSNLITLTPGTVVLG VSDDRTKIYIHAIDFSTKEQEVESIKTSLEKIVREVGEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Irf5 ELISA Kit
orb565532-01 48 Tests

Mouse Irf5 ELISA Kit

Sign In for Pricing
View Details
Mouse Irf5 ELISA Kit
orb565532-02 96 Tests

Mouse Irf5 ELISA Kit

Sign In for Pricing
View Details
Lactalbumin, Alpha (Lactose Synthase B Protein, LALBA, LYZL7) discontinued
L1005-05A 100 µg

Lactalbumin, Alpha (Lactose Synthase B Protein, LALBA, LYZL7) discontinued

Sign In for Pricing
View Details
NBPF11 Protein Vector (Human) (pPB-N-His)
PV103735 500 ng

NBPF11 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
PNPT1 protein (His tag)
80R-4158 0.02 mg

PNPT1 protein (His tag)

Sign In for Pricing
View Details
Rabbit anti-IL-16 Antibody
MBS4504956-01 0.05 mL

Rabbit anti-IL-16 Antibody

Sign In for Pricing
View Details