Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit E1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit E1 spans the amino acid sequence from region 1-159.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit E1, Mnh complex subunit E1

UniProt

P60688

Expression Region

1-159

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVQLVLNFIIAVFWLFVTNSYTTNNFVLGFIFGLVLVYLLHRVLPGRFYVITLYRIIKL VIIFLIELIKANFDVLKIIIKPSIKNEPGFFVYHTDLKKDWQIVLLSNLITLTPGTVVLG VSDDRTKIYIHAIDFSTKEQEVESIKTSLEKIVREVGEI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal UCH-L1/PGP9.5 Antibody (UCHL1/8107R) [Alexa Fluor 488]
NBP3-21061AF488 0.1 mL

Rabbit Monoclonal UCH-L1/PGP9.5 Antibody (UCHL1/8107R) [Alexa Fluor 488]

Sign In for Pricing
View Details
C14orf181 sgRNA CRISPR Lentivector (Human) (Target 2)
K0305903 1.0 µg DNA

C14orf181 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
KRTAP4-12 Protein Vector (Human) (pPB-C-His)
PV023225 500 ng

KRTAP4-12 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Big dynorphin Polyclonal Antibody, Cy5.5 Conjugated
bs-14473R-Cy5.5 100 µL

Big dynorphin Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
tbx5a Antibody
A69558-100UG 100 µg

tbx5a Antibody

Sign In for Pricing
View Details
Acetyl carnitine-d3 HCl
TMIJ-0086-01 1 mg

Acetyl carnitine-d3 HCl

Sign In for Pricing
View Details