Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit E1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit E1 spans the amino acid sequence from region 1-159.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit E1, Mnh complex subunit E1

UniProt

P60688

Expression Region

1-159

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVQLVLNFIIAVFWLFVTNSYTTNNFVLGFIFGLVLVYLLHRVLPGRFYVITLYRIIKL VIIFLIELIKANFDVLKIIIKPSIKNEPGFFVYHTDLKKDWQIVLLSNLITLTPGTVVLG VSDDRTKIYIHAIDFSTKEQEVESIKTSLEKIVREVGEI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNX7 Rabbit pAb (APR27714N)
APR27714N-01 50 µL

SNX7 Rabbit pAb (APR27714N)

Sign In for Pricing
View Details
SNX7 Rabbit pAb (APR27714N)
APR27714N-02 100 µL

SNX7 Rabbit pAb (APR27714N)

Sign In for Pricing
View Details
SNX7 Rabbit pAb (APR27714N)
APR27714N-03 200 µL

SNX7 Rabbit pAb (APR27714N)

Sign In for Pricing
View Details
Recombinant Rat Actin-binding LIM protein 2 (Ablim2)
MBS1439999-01 0.02 mg (E-Coli)

Recombinant Rat Actin-binding LIM protein 2 (Ablim2)

Sign In for Pricing
View Details
Recombinant Rat Actin-binding LIM protein 2 (Ablim2)
MBS1439999-02 0.02 mg (Yeast)

Recombinant Rat Actin-binding LIM protein 2 (Ablim2)

Sign In for Pricing
View Details
Recombinant Rat Actin-binding LIM protein 2 (Ablim2)
MBS1439999-03 0.1 mg (E-Coli)

Recombinant Rat Actin-binding LIM protein 2 (Ablim2)

Sign In for Pricing
View Details