Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Na (+) /H (+) antiporter subunit E1

This Recombinant Na (+) /H (+) antiporter subunit E1 spans the amino acid sequence from region 1-159.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit E1, Mnh complex subunit E1, Mrp complex subunit E1

UniProt

P60690

Expression Region

1-159

Origin

Staphylococcus aureus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVQLVLNFIIAVFWLFVTNSYTTNNFVLGFIFGLVLVYLLHRVLPGRFYVITLYRIIKL VIIFLIELIKANFDVLKIIIKPSIKNEPGFFVYHTDLKKDWQIVLLSNLITLTPGTVVLG VSDDRTKIYIHAIDFSTKEQEVESIKTSLEKIVREVGEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPC6A, NT (TRAPPC6A, Trafficking protein particle complex subunit 6A) (MaxLight 550)
MBS6357600-01 0.1 mL

TPC6A, NT (TRAPPC6A, Trafficking protein particle complex subunit 6A) (MaxLight 550)

Sign In for Pricing
View Details
TPC6A, NT (TRAPPC6A, Trafficking protein particle complex subunit 6A) (MaxLight 550)
MBS6357600-02 5x 0.1 mL

TPC6A, NT (TRAPPC6A, Trafficking protein particle complex subunit 6A) (MaxLight 550)

Sign In for Pricing
View Details
Recombinant Escherichia coli O127:H6 UPF0319 protein YccT (yccT)
MBS1090482-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O127:H6 UPF0319 protein YccT (yccT)

Sign In for Pricing
View Details
Recombinant Escherichia coli O127:H6 UPF0319 protein YccT (yccT)
MBS1090482-02 0.1 mg (E-Coli)

Recombinant Escherichia coli O127:H6 UPF0319 protein YccT (yccT)

Sign In for Pricing
View Details
Recombinant Escherichia coli O127:H6 UPF0319 protein YccT (yccT)
MBS1090482-03 0.02 mg (Yeast)

Recombinant Escherichia coli O127:H6 UPF0319 protein YccT (yccT)

Sign In for Pricing
View Details
Recombinant Escherichia coli O127:H6 UPF0319 protein YccT (yccT)
MBS1090482-04 0.1 mg (Yeast)

Recombinant Escherichia coli O127:H6 UPF0319 protein YccT (yccT)

Sign In for Pricing
View Details