Recombinant Na (+) /H (+) antiporter subunit E1
This Recombinant Na (+) /H (+) antiporter subunit E1 spans the amino acid sequence from region 1-159.
Product Specifications
Product Name Alternative
Na (+) /H (+) antiporter subunit E1, Mnh complex subunit E1, Mrp complex subunit E1
UniProt
P60690
Expression Region
1-159
Origin
Staphylococcus aureus
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAVQLVLNFIIAVFWLFVTNSYTTNNFVLGFIFGLVLVYLLHRVLPGRFYVITLYRIIKL VIIFLIELIKANFDVLKIIIKPSIKNEPGFFVYHTDLKKDWQIVLLSNLITLTPGTVVLG VSDDRTKIYIHAIDFSTKEQEVESIKTSLEKIVREVGEI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6307017-01 0.1 mL
HKDC1, CT (HKDC1, Putative hexokinase HKDC1, Hexokinase domain-containing protein 1) (MaxLight 490)
Sign In for Pricing
View Details MBS6307017-02 5x 0.1 mL
HKDC1, CT (HKDC1, Putative hexokinase HKDC1, Hexokinase domain-containing protein 1) (MaxLight 490)
Sign In for Pricing
View Details A10654-1-PE 100 µg/Vial
Anti-FKBP2 Antibody Picoband® PE Conjugated
Sign In for Pricing
View Details PB9296-Fluoro594 100 µg/Vial
Anti-Neuropeptide Y/NPY Antibody Picoband® Fluoro594 Conjugated
Sign In for Pricing
View Details 