Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit E1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit E1 spans the amino acid sequence from region 1-159.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit E1, Mnh complex subunit E1

UniProt

A5IRC6

Expression Region

1-159

Origin

Staphylococcus aureus (strain JH9)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVQLVLNFIIAVFWLFVTNSYTTNNFVLGFIFGLVLVYLLHRVLPGRFYVITLYRIIKL VIIFLIELIKANFDVLKIIIKPSIKNEPGFFVYHTDLKKDWQIVLLSNLITLTPGTVVLG VSDDRTKIYIHAIDFSTKEQEVESIKTSLEKIVREVGEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTNND1 Mouse mAb Antibody
orb3016071 100 µL

CTNND1 Mouse mAb Antibody

Sign In for Pricing
View Details
KCNE3 Rabbit Polyclonal Antibody (APC-Cy7)
orb2542110 100 µL

KCNE3 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Lentiviral mouse Rnf145 shRNA (UAS) - Lentiviral mouse Rnf145 shRNA (UAS, iRFP) plasmid
GTR15134224 1 Vial

Lentiviral mouse Rnf145 shRNA (UAS) - Lentiviral mouse Rnf145 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
SARS-CoV-2 - nucleocapsid protein - 48.3 kDa
orb1733565 200 µg

SARS-CoV-2 - nucleocapsid protein - 48.3 kDa

Sign In for Pricing
View Details
Human AADAC Knockout HEK293T cell line
GTR15422889 1 Vial

Human AADAC Knockout HEK293T cell line

Sign In for Pricing
View Details
TK1 (Thymidine Kinase 1, Soluble, TK2) (FITC)
MBS6177200-01 0.1 mL

TK1 (Thymidine Kinase 1, Soluble, TK2) (FITC)

Sign In for Pricing
View Details