Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit E1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit E1 spans the amino acid sequence from region 1-159.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit E1, Mnh complex subunit E1

UniProt

A5IRC6

Expression Region

1-159

Origin

Staphylococcus aureus (strain JH9)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVQLVLNFIIAVFWLFVTNSYTTNNFVLGFIFGLVLVYLLHRVLPGRFYVITLYRIIKL VIIFLIELIKANFDVLKIIIKPSIKNEPGFFVYHTDLKKDWQIVLLSNLITLTPGTVVLG VSDDRTKIYIHAIDFSTKEQEVESIKTSLEKIVREVGEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABI2 rabbit pAb
MBS8599228-01 0.1 mL

ABI2 rabbit pAb

Sign In for Pricing
View Details
ABI2 rabbit pAb
MBS8599228-02 0.1 mL (AF405L)

ABI2 rabbit pAb

Sign In for Pricing
View Details
ABI2 rabbit pAb
MBS8599228-03 0.1 mL (AF405S)

ABI2 rabbit pAb

Sign In for Pricing
View Details
ABI2 rabbit pAb
MBS8599228-04 0.1 mL (AF610)

ABI2 rabbit pAb

Sign In for Pricing
View Details
ABI2 rabbit pAb
MBS8599228-05 0.1 mL (AF635)

ABI2 rabbit pAb

Sign In for Pricing
View Details
ABI2 rabbit pAb
MBS8599228-06 0.1 mL (APC)

ABI2 rabbit pAb

Sign In for Pricing
View Details