Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit E1
This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit E1 spans the amino acid sequence from region 1-159.
Product Specifications
Product Name Alternative
Na (+) /H (+) antiporter subunit E1, Mnh complex subunit E1
UniProt
A8Z055
Expression Region
1-159
Origin
Staphylococcus aureus (strain USA300 / TCH1516)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAVQLVLNFIIAVFWLFVTNSYTTNNFVLGFIFGLVLVYLLHRVLPGRFYVITLYRIIKL VIIFLIELIKANFDVLKIIIKPSIKNEPGFFVYHTDLKKDWQIVLLSNLITLTPGTVVLG VSDDRTKIYIHAIDFSTKEQEVESIKTSLEKIVREVGEI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS438234-01 0.02 mg (With BSA & Azide at 0.2mg/mL)
CD6 Mouse Monoclonal Antibody
Sign In for Pricing
View Details MBS438234-02 0.1 mg (With BSA & Azide at 0.2mg/mL)
CD6 Mouse Monoclonal Antibody
Sign In for Pricing
View Details MBS438234-03 0.1 mg (Without BSA & Azide at 1mg/mL)
CD6 Mouse Monoclonal Antibody
Sign In for Pricing
View Details MBS438234-04 5x 0.1 mg (With BSA & Azide at 0.2mg/mL)
CD6 Mouse Monoclonal Antibody
Sign In for Pricing
View Details