Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit E1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit E1 spans the amino acid sequence from region 1-159.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit E1, Mnh complex subunit E1

UniProt

A8Z055

Expression Region

1-159

Origin

Staphylococcus aureus (strain USA300 / TCH1516)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVQLVLNFIIAVFWLFVTNSYTTNNFVLGFIFGLVLVYLLHRVLPGRFYVITLYRIIKL VIIFLIELIKANFDVLKIIIKPSIKNEPGFFVYHTDLKKDWQIVLLSNLITLTPGTVVLG VSDDRTKIYIHAIDFSTKEQEVESIKTSLEKIVREVGEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea Pig IgG (H&L) Antibody
orb346603 50 mg

Guinea Pig IgG (H&L) Antibody

Sign In for Pricing
View Details
AHSG Antibody
orb192278-01 50 μL

AHSG Antibody

Sign In for Pricing
View Details
AHSG Antibody
orb192278-02 100 µL

AHSG Antibody

Sign In for Pricing
View Details
Anti-MORC3 Antibody
MBS1753129-01 0.01 mg

Anti-MORC3 Antibody

Sign In for Pricing
View Details
Anti-MORC3 Antibody
MBS1753129-02 0.1 mg (Carrier Free)

Anti-MORC3 Antibody

Sign In for Pricing
View Details
Anti-MORC3 Antibody
MBS1753129-03 0.1 mg

Anti-MORC3 Antibody

Sign In for Pricing
View Details