Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 42 (TMEM42)

This Recombinant Human Transmembrane protein 42 (TMEM42) spans the amino acid sequence from region 1-159.

Product Specifications

Product Name Alternative

Transmembrane protein 42

UniProt

Q69YG0

Expression Region

1-159

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAERPGPPGGAVSATAYPDTPAEFPPHLQAGAMRRRFWGVFNCLCAGAFGALAAASAKLA FGSEVSMGLCVLGIIVMASTNSLMWTFFSRGLSFSMSSAIASVTVTFSNILSSAFLGYVL YGECQEVLWWGGVFLILCGLTLIHRKLPPTWKPLPHKQQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ponceau S Solution
#22001 1x 1 L

Ponceau S Solution

Sign In for Pricing
View Details
Human PCDHGA6 activation kit by CRISPRa
GA111107 1 Kit

Human PCDHGA6 activation kit by CRISPRa

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1527), 1mg/mL
BNUM1950-50 1x 50 µL

Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1527), 1mg/mL

Sign In for Pricing
View Details
CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/2343), CF640R conjugate, 0.1mg/mL
BNC402343-100 1x 100 µL

CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/2343), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ornithine Decarboxylase-1 (ODC-1) (ODC1/2878R), CF647 conjugate, 0.1mg/mL
BNC472878-100 1x 100 µL

Ornithine Decarboxylase-1 (ODC-1) (ODC1/2878R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ethyl Propargylate-13C3
TRC-E818062-50MG 50 mg

Ethyl Propargylate-13C3

Sign In for Pricing
View Details