Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit E1 (mnhE1)

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit E1 (mnhE1) spans the amino acid sequence from region 1-159.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit E1, Mnh complex subunit E1

UniProt

Q2G2H8

Expression Region

1-159

Origin

Staphylococcus aureus (strain NCTC 8325)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVQLVLNFIIAVFWLFVTNSYTTNNFVLGFIFGLVLVYLLHRVLPGRFYVITLYRIIKL VIIFLIELIKANFDVLKIIIKPSIKNEPGFFVYHTDLKKDWQIVLLSNLITLTPGTVVLG VSDDRTKIYIHAIDFSTKEQEVESIKTSLEKIVREVGEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCK Adaptor Protein 1 Human Recombinant
rAP-3693 1 Each

NCK Adaptor Protein 1 Human Recombinant

Sign In for Pricing
View Details
TCTEX1D2 Protein Vector (Rat) (pPM-C-HA)
PV310232 500 ng

TCTEX1D2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
MOB1A Antibody (HRP)
orb352034-01 50 µg

MOB1A Antibody (HRP)

Sign In for Pricing
View Details
MOB1A Antibody (HRP)
orb352034-02 100 µg

MOB1A Antibody (HRP)

Sign In for Pricing
View Details
ATF7IP2 Antibody / MCAF2
F54547-0.4ML 0.4 mL

ATF7IP2 Antibody / MCAF2

Sign In for Pricing
View Details
Specimen Preservation Reagent
DA0970 100 test/kit

Specimen Preservation Reagent

Sign In for Pricing
View Details