Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus haemolyticus Na (+) /H (+) antiporter subunit E1 (mnhE1)

This Recombinant Staphylococcus haemolyticus Na (+) /H (+) antiporter subunit E1 (mnhE1) spans the amino acid sequence from region 1-159.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit E1, Mnh complex subunit E1

UniProt

Q4L4W3

Expression Region

1-159

Origin

Staphylococcus haemolyticus (strain JCSC1435)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAIQIILNFILAFIWIFLSGSYTLNNLLLGFILGLGFVYLFSRILPGRFYFIKIYKILKL AVVFFVELLKANIDVLKIVLQPKLKNEPGFFVYHTDLKTDWQIVLLSNLITLTPGTVVLG ISDDRKKIYIHSIDFSTKEEEVEGIKSSLEKVVREVGED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Mouse OCT4 antibody
OCT411-A 100 µg

Rabbit anti-Mouse OCT4 antibody

Sign In for Pricing
View Details
Gps1 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7106004 1.0 µg DNA

Gps1 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
hsa-miR-517a-3p Primers
MPH03149 150 µL / 10 µM

hsa-miR-517a-3p Primers

Sign In for Pricing
View Details
Rabbit Monoclonal Caveolin-1 Antibody (2A7)
NBP3-26695-50ul 50 µL

Rabbit Monoclonal Caveolin-1 Antibody (2A7)

Sign In for Pricing
View Details
Porcine Alpha-Actin, α Actin ELISA Kit
YLA0163PO-01 48 Tests

Porcine Alpha-Actin, α Actin ELISA Kit

Sign In for Pricing
View Details
Porcine Alpha-Actin, α Actin ELISA Kit
YLA0163PO-02 96 Tests

Porcine Alpha-Actin, α Actin ELISA Kit

Sign In for Pricing
View Details