Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit E1 (mnhE1)

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit E1 (mnhE1) spans the amino acid sequence from region 1-159.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit E1, Mnh complex subunit E1

UniProt

Q5HHD7

Expression Region

1-159

Origin

Staphylococcus aureus (strain COL)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVQLVLNFIIAVFWLFVTNSYTTNNFVLGFIFGLVLVYLLHRVLPGRFYVITLYRIIKL VIIFLIELIKANFDVLKIIIKPSIKNEPGFFVYHTDLKKDWQIVLLSNLITLTPGTVVLG VSDDRTKIYIHAIDFSTKEQEVESIKTSLEKIVREVGEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Low Density Lipoprotein Receptor Related Protein 6 (LRP6) ELISA Kit
EK15300 48 Tests

Human Low Density Lipoprotein Receptor Related Protein 6 (LRP6) ELISA Kit

Sign In for Pricing
View Details
2,2'-Bithiophene-5-boronic acid
419493-01 100 mg

2,2'-Bithiophene-5-boronic acid

Sign In for Pricing
View Details
2,2'-Bithiophene-5-boronic acid
419493-02 250 mg

2,2'-Bithiophene-5-boronic acid

Sign In for Pricing
View Details
MST1L Rabbit Polyclonal Antibody
orb3070672-01 30 µL

MST1L Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MST1L Rabbit Polyclonal Antibody
orb3070672-02 50 µL

MST1L Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MST1L Rabbit Polyclonal Antibody
orb3070672-03 100 µL

MST1L Rabbit Polyclonal Antibody

Sign In for Pricing
View Details