Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Vesicle transport protein SFT2A (Sft2d1)

This Recombinant Mouse Vesicle transport protein SFT2A (Sft2d1) spans the amino acid sequence from region 1-159.

Product Specifications

Product Name Alternative

Vesicle transport protein SFT2A, SFT2 domain-containing protein 1

UniProt

Q5SSN7

Expression Region

1-159

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKLRRVLSGQDDEEQGLTAQVLDASSLSFNTRLKWFVICFVAGIFFSFLGTGLLWLPNG MKLFAVFYTLGNLAALASTCFLMGPVKQLKKMFETTRLLATIIMLLCLVFTLCAALWWRK KGLALLFCILQFLSMTWYSLSYIPYARDAVLKCCSSLLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclohexene
TRC-C987513-5ML 5 mL

Cyclohexene

Sign In for Pricing
View Details
GP2 (Glycoprotein 2) / ZAP75 (GP2/1805), CF568 conjugate, 0.1mg/mL
BNC681805-100 1x 100 µL

GP2 (Glycoprotein 2) / ZAP75 (GP2/1805), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C15orf65 Human Gene Knockout Kit (CRISPR)
KN430956 1 Kit

C15orf65 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
OR4K14 Antibody
8G605-AAT 50 µg

OR4K14 Antibody

Sign In for Pricing
View Details
P21WAF1 (Tumor Suppressor Protein) (CIP1/2489R), 0.2mg/mL
BNUB2489-100 1x 100 µL

P21WAF1 (Tumor Suppressor Protein) (CIP1/2489R), 0.2mg/mL

Sign In for Pricing
View Details
RPUSD1 (NM_058192) Human Recombinant Protein
TP304013L 1 mg

RPUSD1 (NM_058192) Human Recombinant Protein

Sign In for Pricing
View Details