Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Vesicle transport protein SFT2A (Sft2d1)

This Recombinant Rat Vesicle transport protein SFT2A (Sft2d1) spans the amino acid sequence from region 1-159.

Product Specifications

Product Name Alternative

Vesicle transport protein SFT2A, SFT2 domain-containing protein 1

UniProt

Q5U3Y5

Expression Region

1-159

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKLRRVLSGQDDEEQGLTAQVLDASSLSFNTRLKWFVICFVAGIFFSILGTGLLWLPNG VKLFAVFYTLGNLAALASTCFLMGPVKQLKKMFETTRLLATIIMLLCLVFTLCAALWWRK KGLALLFCILQFLSMTWYSLSYIPYARDAVLKCCSSILS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Pancreas
CR560781 5 µg

Tissue Total RNA, Pancreas

Sign In for Pricing
View Details
Tissue FFPE Sections, Stomach
CS702794 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
Dnajc24 (NM_026992) Mouse Tagged ORF Clone
MG201010 10 µg

Dnajc24 (NM_026992) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Mouse LIF Antibody Pair Set
E-KAB-0595 50 µL & 100 µg

Mouse LIF Antibody Pair Set

Sign In for Pricing
View Details
Integrin alpha E (ITGAE) Mouse Monoclonal Antibody [Clone ID: B-ly7]
AM39027PU-N 1 mL

Integrin alpha E (ITGAE) Mouse Monoclonal Antibody [Clone ID: B-ly7]

Sign In for Pricing
View Details
Blood Group Antigen B (CD173) (HEB-20), CF488A conjugate, 0.1mg/mL
BNC880296-100 1x 100 µL

Blood Group Antigen B (CD173) (HEB-20), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details