Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Olfactory receptor-like protein COR8 (COR8)

This Recombinant Chicken Olfactory receptor-like protein COR8 (COR8) spans the amino acid sequence from region 1-159.

Product Specifications

Product Name Alternative

Olfactory receptor-like protein COR8

UniProt

Q98913

Expression Region

1-159

Origin

Gallus gallus (Chicken)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

VAICNPLLYTISMPKSLCMKLVAGSYLGGVLNSLTQTCCLLPLPFCGPNVINHYFCDTNP LLKLTCSDGRLNELLLVTFNGTISMTVLLIIVISYVYILVSILSIRSARGRHKAFSTCAS HLLTVTLFYVPAGLSHMQPGSKYSLDMEKVTAVFYTLLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant TCEA1 Antibody
RC-4979-01 50 μL

Recombinant TCEA1 Antibody

Sign In for Pricing
View Details
Recombinant TCEA1 Antibody
RC-4979-02 100 µL

Recombinant TCEA1 Antibody

Sign In for Pricing
View Details
Recombinant TCEA1 Antibody
RC-4979-03 1 mL

Recombinant TCEA1 Antibody

Sign In for Pricing
View Details
HMX2 (NM_005519) Human Over-expression Lysate
LC401694 20 µg

HMX2 (NM_005519) Human Over-expression Lysate

Sign In for Pricing
View Details
PTMS Human Gene Knockout Kit (CRISPR)
KN401984 1 Kit

PTMS Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
8-Thioguanosine
TRC-T350788-1MG 1 mg

8-Thioguanosine

Sign In for Pricing
View Details