Recombinant Pongo abelii Peripheral myelin protein 22 (PMP22)
This Recombinant Pongo abelii Peripheral myelin protein 22 (PMP22) spans the amino acid sequence from region 1-160.
Product Specifications
Product Name Alternative
Peripheral myelin protein 22, PMP-22
UniProt
Q5RAZ3
Expression Region
1-160
Origin
Pongo abelii (Sumatran orangutan)
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MLLLLLSIIVLHVAVLVLLFVSTIVSQWIVGNGHATDLWQNCSTSSSGNVHHCFSSSPNE WLQSVQATMILSIIFSILSLFLFFCQLFTLTKGGRFYITGIFQILAGLCVMSAAAIYTVR HPEWHLNSDYSYGFAYILAWVAFPLALLSGVIYVILRKRE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040008-100 1x 100 µL
MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941429-500 1x 500 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680446-100 1x 100 µL
Cytokeratin, HMW (34BE12), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680718-500 1x 500 µL
HER-2 / CD340 (HRB2/718), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details