Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Heme transporter hrg-5 (hrg-5)

This Recombinant Heme transporter hrg-5 (hrg-5) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

Heme transporter hrg-5, Heme-responsive gene 5 protein, CeHRG-5

UniProt

Q7YTM8

Expression Region

1-160

Origin

Caenorhabditis elegans

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSKISSSRCCTLFCHVNTRIALTILDILIGFSNILSYAIQFHNWSALTLTAMVTLVACH TLQMFLAEKKNTITHWKYSTFKWIMWIDITLGFLALGCFVVCFIIAGVTEIEFTNLYGEN LWFTGLWATAITKYTWQNALLARNYSNQKRILKSEIVEDA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (MX-49.129.5), CF647 conjugate, 0.1mg/mL
BNC470525-100 1x 100 µL

CD63 (MX-49.129.5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF647 conjugate, 0.1mg/mL
BNC470342-500 1x 500 µL

CD43 (84-3C1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF488A conjugate, 0.1mg/mL
BNC880322-500 1x 500 µL

CD3e (RIV9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (TFRC/1149), CF568 conjugate, 0.1mg/mL
BNC681149-100 1x 100 µL

CD71 (TFRC/1149), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR (31G7), CF488A conjugate, 0.1mg/mL
BNC881194-100 1x 100 µL

EGFR (31G7), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (NCAM1/2217R), CF488A conjugate, 0.1mg/mL
BNC882217-500 1x 500 µL

CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (NCAM1/2217R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details