Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Protein TIC 20-v, chloroplastic (TIC20-V)

This Recombinant Arabidopsis thaliana Protein TIC 20-v, chloroplastic (TIC20-V) spans the amino acid sequence from region 50-209.

Product Specifications

Product Name Alternative

Protein TIC 20-v, chloroplastic, Translocon at the inner envelope membrane of chloroplasts 20-V, AtTIC20-v

UniProt

Q9FM67

Expression Region

50-209

Origin

Arabidopsis thaliana (Mouse-ear cress)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QSKGDDSVDASDRIISAVCYFYPFFDGIQYGKFIITQYQPFQILIQPLFPAIRAFKSFPF NGFLIFITLYFVVVRNPNFSRYVRFNTMQAIVLDVLLIFPDLLERSFNPRDGFGLDVVMS LDSTVFLFLLVSLIYGFSACLFGLTPRLPLVAEAADRQVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF594 conjugate, 0.1mg/mL
BNC940158-100 1x 100 µL

Cytokeratin 17 (E3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF568 conjugate, 0.1mg/mL
BNC680039-500 1x 500 µL

CD34 (ICO-115), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF640R conjugate, 0.1mg/mL
BNC400152-100 1x 100 µL

CD11c (HC1/1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL
BNC680679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Milk Fat Globulin (MFG-06), CF740 conjugate, 0.1mg/mL
BNC740227-500 1x 500 µL

Milk Fat Globulin (MFG-06), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (T-Helper/Inducer Cell Marker) (RIV7), CF594 conjugate, 0.1mg/mL
BNC940362-500 1x 500 µL

CD4 (T-Helper/Inducer Cell Marker) (RIV7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details