Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Epithelial membrane protein 1 (Emp1)

This Recombinant Mouse Epithelial membrane protein 1 (Emp1) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

Epithelial membrane protein 1, EMP-1, Tumor-associated membrane protein

UniProt

P47801

Expression Region

1-160

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLVLLAGLFVVHIATAIMLFVSTIANVWMVADYANASVGLWKNCTGGNCDGSLSYGNEDA IKAVQAFMILSIIFSIISLVVFVFQLFTMEKGNRFFLSGSTMLVCWLCILVGVSIYTHHY AHSEGNFNSSSHQGYCFILTWICFCFSFIIGILYMVLRKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Ovary: right
CS800516 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details
Recombinant Cenexin1 Antibody
RC-15840-01 50 μL

Recombinant Cenexin1 Antibody

Sign In for Pricing
View Details
Recombinant Cenexin1 Antibody
RC-15840-02 100 µL

Recombinant Cenexin1 Antibody

Sign In for Pricing
View Details
Recombinant Cenexin1 Antibody
RC-15840-03 1 mL

Recombinant Cenexin1 Antibody

Sign In for Pricing
View Details
ZUP1 (NM_145062) Human Over-expression Lysate
LY403421 100 µg

ZUP1 (NM_145062) Human Over-expression Lysate

Sign In for Pricing
View Details
XKR4 Human Gene Knockout Kit (CRISPR)
KN418548 1 Kit

XKR4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details