Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Epithelial membrane protein 1 (EMP1)

This Recombinant Rabbit Epithelial membrane protein 1 (EMP1) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

Epithelial membrane protein 1, EMP-1, Squamous cell-specific protein CL-20, Tumor-associated membrane protein

UniProt

P54850

Expression Region

1-160

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLVLLAAIFVVHIATCVMLFVSTIANVWVVSDSINASVGLWRNCTSGDCSGGLSYGHEDA LKAVQAFMILSIIFSVISLIIFVFQLFTMEKGNRFFLSGATMLVCWLCVLIGASIYTHRY ANGDSNTFDRSHHGYSFILAWICFCFSFVVGVLYLVLRKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bcl x (BCL2L1) (Bcl-xS) Rabbit Polyclonal Antibody
AP23387PU-N 100 µg

Bcl x (BCL2L1) (Bcl-xS) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DL-2,4-Diaminobutyric Acid Dihydrochloride
TRC-D453553-50MG 50 mg

DL-2,4-Diaminobutyric Acid Dihydrochloride

Sign In for Pricing
View Details
CD45RA (Leukocyte Marker) (K4B5), 1mg/mL
BNUM1680-50 1x 50 µL

CD45RA (Leukocyte Marker) (K4B5), 1mg/mL

Sign In for Pricing
View Details
Recombinant Mouse Cadherin-6/CDH6 Protein (His Tag)
PKSM040405 100 µg

Recombinant Mouse Cadherin-6/CDH6 Protein (His Tag)

Sign In for Pricing
View Details
KIAA0664 (CLUH) Human Gene Knockout Kit (CRISPR)
KN420737 1 Kit

KIAA0664 (CLUH) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Von Willebrand Factor Antibody
KC-26347-01 50 μL

Von Willebrand Factor Antibody

Sign In for Pricing
View Details