Recombinant Synechocystis sp. Tic20 family protein (sll1737)
This Recombinant Synechocystis sp. Tic20 family protein (sll1737) spans the amino acid sequence from region 1-160.
Product Specifications
Product Name Alternative
Tic20 family protein
UniProt
P73387
Expression Region
1-160
Origin
Synechocystis sp. (strain PCC 6803 / Kazusa)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MASNSTADGKDRFFSALIYVIPLIDAFMFGGFLLQQFPVLQIIYLPIMPLLQFYYQFPFA SFIIFIVLFMAVVRNNNISHFIRFNAMQAILIGILLSLFGLIVAYVIQPVFGQGLVTETL YNFAFLGALACGFFGIVQSVLGRYAEIPTISDAAYSQVRF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC741073-500 1x 500 µL
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740676-500 1x 500 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881221-500 1x 500 µL
Cytokeratin 8/18 (B22.1 + B23.1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details