Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Mb1335 (Mb1335)

This Recombinant Uncharacterized protein Mb1335 (Mb1335) spans the amino acid sequence from region 1-161.

Product Specifications

Product Name Alternative

Uncharacterized protein Mb1335

UniProt

P64802

Expression Region

1-161

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTPAQDAPLVFPSVAFRPVRLFFINVGLAAVAMLVAGVFGHLTVGMFLGLGLLLGLLNA LLVRRSAESITAKEHPLKRSMALNSASRLAIITILGLIIAYIFRPAGLGVVFGLAFFQVL LVATTALPVLKKLRTATEEPVATYSSNGQTGGSEGRSASDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (LPFS2/2034R), 0.2mg/mL
BNUB2034-100 1x 100 µL

CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (LPFS2/2034R), 0.2mg/mL

Sign In for Pricing
View Details
Recombinant Human MAP2 Protein (Trx Tag)
PDEH100647-01 20 µg

Recombinant Human MAP2 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human MAP2 Protein (Trx Tag)
PDEH100647-02 100 µg

Recombinant Human MAP2 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human MAP2 Protein (Trx Tag)
PDEH100647-03 500 µg

Recombinant Human MAP2 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human MAP2 Protein (Trx Tag)
PDEH100647-04 1 mg

Recombinant Human MAP2 Protein (Trx Tag)

Sign In for Pricing
View Details
VC DNA Ladder Mix, 50µg
NL1417 50 µg

VC DNA Ladder Mix, 50µg

Sign In for Pricing
View Details