Recombinant Staphylococcus epidermidis Lipoprotein signal peptidase (lspA)
This Recombinant Staphylococcus epidermidis Lipoprotein signal peptidase (lspA) spans the amino acid sequence from region 1-161.
Product Specifications
Product Name Alternative
Lipoprotein signal peptidase, EC= 3.4.23.36, Prolipoprotein signal peptidase, Signal peptidase II, SPase II
UniProt
Q5HPZ5
Expression Region
1-161
Origin
Staphylococcus epidermidis (strain ATCC 35984 / RP62A)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MKKKYYISISLLMTFIVLVFDQVSKWLITISMKVGDSYEIIPNFLNITSHRNNGAAWGIL SGKMLFFYIITIIILIVLVIFYIKEAQFNLFMQVAISLLFAGALGNFIDRVLHGEVVDFI DTNIFGYDFPIFNIADSSLTIGVIFVIITLIKDAIINKKEV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC681003-100 1x 100 µL
Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880009-100 1x 100 µL
MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040262-500 1x 500 µL
Human Lambda Light Chain (HP6054), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472168-100 1x 100 µL
Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2168), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details