Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSAP/Prosaposin, Rat (HEK293, His)

PSAP (or Prosaposin) has multiple functions, including ganglioside binding, protein homodimerization, and scaffolding protein binding.It is involved in processes such as GM1 transport, β-galactosidase regulation, and prostate development.PSAP/Prosaposin Protein, Rat (HEK293, His) is the recombinant rat-derived PSAP/Prosaposin protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

PSAP/Prosaposin Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/psap-prosaposin-protein-rat-hek293-his.html

Purity

97.30

Smiles

SPVQDPKICSGGSAVVCRDVKTAVDCRAVKHCQQMVWSKPTAKSLPCDICKTVVTEAGNLLKDNATEEEILHYLEKTCAWIHDSSLSASCKEVVDSYLPVILDMIKGEMSNPGEVCSALNLCQSLQEYLAEQNQRQLESNKIPEVDLARVVAPFMSNIPLLLYPQDRPRSQPQPKANEDVCQDCMKLVTDIQTAVRTNSSFVQGLVDHVKEDCDRLGPGVSDICKNYVDQYSEVAVQMMMHMQPKEICVMVGFCDEVKRVPMRTLVPATEAIKNILPALELTDPYEQDVIQAQNVIFCQVCQLVMRKLSELIINNATEELLIKGLSKACSLLPAPASTKCQEVLVTFGPSLLDVLMHEVNPNFLCGVISLCSANPNLVGTLEQPAAAIVSALPKEPAPPKQPEEPKQSALRAHVPPQKNGGFCEVCKKLVIYLEHNLEKNSTKEEILAALEKGCSFLPDPYQKQCDEFVAEYEPLLLEILVEVMDPSFVCSKIGVCPSAYKLLLGTEKCVWGPGYWCQNMETAARCNAVDHCKRHVWN

Molecular Formula

25524 (Gene_ID) NP_037145.2 (S17-N554) (Accession)

Molecular Weight

Approximately 55-75 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse ORM1-like protein 3, Ormdl3 ELISA KIT
ELI-43211m 96 Tests

Mouse ORM1-like protein 3, Ormdl3 ELISA KIT

Sign In for Pricing
View Details
Freeze Dryer BFBT-104-B
BFBT-104-B 1 Unit

Freeze Dryer BFBT-104-B

Sign In for Pricing
View Details
TGF beta Receptor III Polyclonal Antibody, Biotin Conjugated
bs-1910R-Biotin 100 µL

TGF beta Receptor III Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
PI 3-kinase p85β Polyclonal Antibody
RA20828-01 50 µL

PI 3-kinase p85β Polyclonal Antibody

Sign In for Pricing
View Details
PI 3-kinase p85β Polyclonal Antibody
RA20828-02 100 µL

PI 3-kinase p85β Polyclonal Antibody

Sign In for Pricing
View Details
FAM156B (NM_001099684) Human Over-expression Lysate
LS727866-100ug 100 µg

FAM156B (NM_001099684) Human Over-expression Lysate

Sign In for Pricing
View Details