Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oryza sativa subsp. indica CASP-like protein BLE3 (BLE3)

This Recombinant Oryza sativa subsp. indica CASP-like protein BLE3 (BLE3) spans the amino acid sequence from region 1-162.

Product Specifications

Product Name Alternative

CASP-like protein BLE3, Protein brassinolide-enhanced BLE3, OsBLE3, Protein BL-enhanced 3

UniProt

A2Y2B7

Expression Region

1-162

Origin

Oryza sativa subsp. indica (Rice)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAKVHRLMNAVLRLAAAAAAATAAVVMVTSRETTSFFGIQMEAKYSYTPSFIFFVVAYAV AAAYSLLVLAVPAGSALSRLALTTDVVLGMVLAGAVASAGAISDIAKNGNSHAGWLPVCG QIHAYCNHVMAALIAGFVALAVHFVVVMYSLHIVTDVICPCH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Kidney
CS702599 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Frozen Tissue Sections, Pancreas
CS643234 5x 5 µm

Frozen Tissue Sections, Pancreas

Sign In for Pricing
View Details
Eg5 (KIF11) Human Gene Knockout Kit (CRISPR)
KN218842RB 1 Kit

Eg5 (KIF11) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
5- (and-6) -Carboxy SNARF-4F Maleimide
21172-AAT 1 mg

5- (and-6) -Carboxy SNARF-4F Maleimide

Sign In for Pricing
View Details
Bcl-X (Apoptosis Marker) (BCL2L1/1762), Biotin conjugate, 0.1mg/mL
BNCB1762-500 1x 500 µL

Bcl-X (Apoptosis Marker) (BCL2L1/1762), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Adipic Acid-d4 (Major)
TRC-A291594-10MG 10 mg

Adipic Acid-d4 (Major)

Sign In for Pricing
View Details