Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2041 (AF_2041)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2041 (AF_2041) spans the amino acid sequence from region 1-162.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_2041

UniProt

O28238

Expression Region

1-162

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVLAIIFLLNLKPTIYSIVGIFLIIILDVTVAVALYFLLRPVSKNISMLMSLFRIVYAA IFTTALYKIHDLTAFYSILDLGYIFFGIHLFLLGFLVYKSGYMPKWLGALIFIASTGYII DPLLRFSGYAVEIGMYTFFGEVLFAFWLVIKGRKLSEVVSTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ajmaline
TRC-A448000-50MG 50 mg

Ajmaline

Sign In for Pricing
View Details
WRCH1 (RHOU) Rabbit Polyclonal Antibody
TA380924 100 µL

WRCH1 (RHOU) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RealStar®PIV RT-PCR Kit 2.0 RUO
262003 96 Tests

RealStar®PIV RT-PCR Kit 2.0 RUO

Sign In for Pricing
View Details
MAGE 1 (MAGEA1) Human Gene Knockout Kit (CRISPR)
KN202134LP 1 Kit

MAGE 1 (MAGEA1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Serum Amyloid A (SAA/2868R), CF594 conjugate, 0.1mg/mL
BNC942868-500 1x 500 µL

Serum Amyloid A (SAA/2868R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GAJ (MND1) Rabbit Polyclonal Antibody
TA362759 100 µL

GAJ (MND1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details