Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus tropicalis Transmembrane protein 138 (tmem138)

This Recombinant Xenopus tropicalis Transmembrane protein 138 (tmem138) spans the amino acid sequence from region 1-162.

Product Specifications

Product Name Alternative

Transmembrane protein 138

UniProt

Q66JC0

Expression Region

1-162

Origin

Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLQPGNYSLVLSLQFLLLLFDLFVNSFSELLRDPPVNQLVLFILQDVGILFAAIVLFLML FNTFVFQAGLVSLLCQRFQVTVILCAVYIALSISLHVWLMNLRWTGANRFVWSDGLLALF VLQRFVAVLYFYYYKRTALSMGDSRFYHDSLWLRKEFARVRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL
BNC680304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL
BNC040978-100 1x 100 µL

CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF647 conjugate, 0.1mg/mL
BNC470449-100 1x 100 µL

CD104 (UM-A9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL
BNC040029-500 1x 500 µL

Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL
BNC940270-500 1x 500 µL

Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-DRB (HLA-DRB/1067), CF640R conjugate, 0.1mg/mL
BNC401067-100 1x 100 µL

HLA-DRB (HLA-DRB/1067), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details