Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 138 (Tmem138)

This Recombinant Mouse Transmembrane protein 138 (Tmem138) spans the amino acid sequence from region 1-162.

Product Specifications

Product Name Alternative

Transmembrane protein 138

UniProt

Q9D6G5

Expression Region

1-162

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLQTGNYSLVLSLQFLLLSYDLFVNSFSELLRMAPVIQLVLFIIQDIAILFNIIIIFLMF FNTFVFQAGLVNLLFHKFKGTIILTSVYLALSISLHVWVMNVRWKNSSSFSWTNGLQTLF VFQRLAAVLYCYFYKRTAVRLGDPRFYQDSLWLRKEFMQVRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trovafloxacin
TRC-T892760-2.5MG 2.5 mg

Trovafloxacin

Sign In for Pricing
View Details
Ankrd45 Mouse Gene Knockout Kit (CRISPR)
KN501293 1 Kit

Ankrd45 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD40 Ligand / CD154 / TRAP1 (Activation Marker of T-Lymphocytes) (CD40LG/2761), CF640R conjugate, 0.1mg/mL
BNC402761-500 1x 500 µL

CD40 Ligand / CD154 / TRAP1 (Activation Marker of T-Lymphocytes) (CD40LG/2761), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Anti Human DLK1 Polyclonal
Y054739 100 µL

Anti Human DLK1 Polyclonal

Sign In for Pricing
View Details
CEP55 Antibody
KC-2830-01 50 μL

CEP55 Antibody

Sign In for Pricing
View Details
CEP55 Antibody
KC-2830-02 100 µL

CEP55 Antibody

Sign In for Pricing
View Details