Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nitrosomonas eutropha Disulfide bond formation protein B (dsbB)

This Recombinant Nitrosomonas eutropha Disulfide bond formation protein B (dsbB) spans the amino acid sequence from region 1-162.

Product Specifications

Product Name Alternative

Disulfide bond formation protein B, Disulfide oxidoreductase

UniProt

Q0AFX4

Expression Region

1-162

Origin

Nitrosomonas eutropha (strain C91)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRIIFLLIFLACAGLIGYALYLQLMDGLLPCPLCIFQRIAYWLIGITALFTFIHNPQSLG QHIYYGLIILFSLAGAIVAGRQAWLIRFPEAFECGISPEEAFLNGLPLAQWWPNMFEANG DCNDGTWQFLSLTLPDWSLLIFAAFGIIAGLLWHKKYNSINQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H2AFY Antibody
A24286-100UL 100 µL

H2AFY Antibody

Sign In for Pricing
View Details
8-iso-PGF2α (8-isoprostane) ELISA Kit
EKF57992 96 Tests

8-iso-PGF2α (8-isoprostane) ELISA Kit

Sign In for Pricing
View Details
PARP1, phosphorylated (S782) (PARP1, ADPRT, PPOL, Poly [ADP-ribose] polymerase 1, ADP-ribosyltransferase diphtheria toxin-like 1, NAD (+) ADP-ribosyltransferase 1, Poly[ADP-ribose] synthase 1) (MaxLight 550) discontinued
039673-ML550 100 µL

PARP1, phosphorylated (S782) (PARP1, ADPRT, PPOL, Poly [ADP-ribose] polymerase 1, ADP-ribosyltransferase diphtheria toxin-like 1, NAD (+) ADP-ribosyltransferase 1, Poly[ADP-ribose] synthase 1) (MaxLight 550) discontinued

Sign In for Pricing
View Details
FucT-IV (h) -PR
sc-40585-PR 10 µM - 20 µL

FucT-IV (h) -PR

Sign In for Pricing
View Details
C1QB Rabbit pAb
E45R25741N-50 50 µL

C1QB Rabbit pAb

Sign In for Pricing
View Details
LONP2 Antibody
orb674783-01 50 µg

LONP2 Antibody

Sign In for Pricing
View Details