Recombinant Xenopus laevis Promethin-B (tmem159-b)
This Recombinant Xenopus laevis Promethin-B (tmem159-b) spans the amino acid sequence from region 1-162.
Product Specifications
Product Name Alternative
Promethin-B, Transmembrane protein 159-B
UniProt
Q6GM19
Expression Region
1-162
Origin
Xenopus laevis (African clawed frog)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MASAEKLYREKMQELQKQLNKFMQTINNHSKVDAFLNSPFGQYLDEHPFVTLSLLVFVSL SVVPAGLFLTLVAGTAIAVCLAVLIIEGIVISVSGIALLCILCGLAVMSLGVAAILCVSY VAGSSVFNYMHAYRVAVGTRERSGPISLNHKMTMAEKSLSSS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940270-500 1x 500 µL
Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741820-100 1x 100 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740669-500 1x 500 µL
P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740994-100 1x 100 µL
TNF alpha (J2D10), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401908-500 1x 500 µL
PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B7), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details