Recombinant Oryza sativa subsp. japonica CASP-like protein BLE3 (BLE3)
This Recombinant Oryza sativa subsp. japonica CASP-like protein BLE3 (BLE3) spans the amino acid sequence from region 1-162.
Product Specifications
Product Name Alternative
CASP-like protein BLE3, Protein brassinolide-enhanced 3, OsBLE3, Protein BL-enhanced 3
UniProt
Q84UT5
Expression Region
1-162
Origin
Oryza sativa subsp. japonica (Rice)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAKVHRLMNAVLRLAAAAAAATAAVVMVTSRETTSFFGIQMEAKYSYTPSFIFFVVAYAV AAAYSLLVLAVPAGSALSRLALTTDVVLGMVLAGAVASAGAISDIAKNGNSHAGWLPVCG QIHAYCNHVMAALIAGFVALAVHFVVVMYSLHIVTDVICPCH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740043-500 1x 500 µL
P21 / WAF1 (WA-1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401429-100 1x 100 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680031-100 1x 100 µL
Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040201-500 1x 500 µL
CD2 / Lymphocyte Function Antigen 2 (LFA-2) (UMCD2), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740670-100 1x 100 µL
CD66 (CEA) (CEA31), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details