Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas stutzeri Disulfide bond formation protein B (dsbB)

This Recombinant Pseudomonas stutzeri Disulfide bond formation protein B (dsbB) spans the amino acid sequence from region 1-163.

Product Specifications

Product Name Alternative

Disulfide bond formation protein B, Disulfide oxidoreductase

UniProt

A4VGY3

Expression Region

1-163

Origin

Pseudomonas stutzeri (strain A1501)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRLASPRSLFVIAFLGSALLIAIALYMEHVMGLAPCPLCIVQRICVIGFGLVCLVAAIHG PAKVGRRVYAAIAALFVAAGAATAIRQIWLQSVPADQLPSCLPSLEYMMEALPFQEIARL VLHGTAECAEVSWTMLGMSIPEWSLLGFIGMAIVCLWQLLRRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pygo1 Mouse Gene Knockout Kit (CRISPR)
KN514292 1 Kit

Pygo1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
KREMEN1 (NM_001039570) Human Over-expression Lysate
LY422073 100 µg

KREMEN1 (NM_001039570) Human Over-expression Lysate

Sign In for Pricing
View Details
NED Dye qPCR Calibration Solution *10,000X*
67031-AAT 100 µL

NED Dye qPCR Calibration Solution *10,000X*

Sign In for Pricing
View Details
MUC2 (Mucin 2) (MLP/2970R), CF594 conjugate, 0.1mg/mL
BNC942970-100 1x 100 µL

MUC2 (Mucin 2) (MLP/2970R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MRGPRF (NM_145015) Human Recombinant Protein
TP304556M 100 µg

MRGPRF (NM_145015) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse CRP Recombinant Rabbit monoclonal Antibody
HA725075B 100 µL

Mouse CRP Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details